PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_17494A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 456aa    MW: 49881.8 Da    PI: 6.3231
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_17494AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding568.8e-182471148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd++l+d+v+ +G g+W+ +    g++R++k+c++rw ++l
  Oropetium_20150105_17494A 24 KGPWTPEEDKRLADYVQAHGEGSWNQVRINAGLNRCGKSCRLRWSNHL 71
                               79*******************************************996 PP

2Myb_DNA-binding35.32.6e-1182120646
                                HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                +eE e++++ +  +G++ W++ a+ ++ gRt++++k++w++
  Oropetium_20150105_17494A  82 AEEIEKIYRMHMAWGNK-WAKMAAQLP-GRTDNEIKNFWNT 120
                                8****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.161975IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-212073IPR009057Homeodomain-like
SuperFamilySSF466895.74E-2722118IPR009057Homeodomain-like
SMARTSM007173.1E-142373IPR001005SANT/Myb domain
PfamPF002491.7E-162471IPR001005SANT/Myb domain
CDDcd001672.35E-102671No hitNo description
Gene3DG3DSA:1.10.10.606.1E-1974124IPR009057Homeodomain-like
SMARTSM007177.8E-1276124IPR001005SANT/Myb domain
PROSITE profilePS5129413.54776126IPR017930Myb domain
PfamPF002494.8E-1082120IPR001005SANT/Myb domain
CDDcd001679.31E-982122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MTAPTPTARD GAARRRGGQS QLKKGPWTPE EDKRLADYVQ AHGEGSWNQV RINAGLNRCG  60
KSCRLRWSNH LRPDLKKVPL DAEEIEKIYR MHMAWGNKWA KMAAQLPGRT DNEIKNFWNT  120
RLKRIQKSGL PIYPDHLHLQ PSNQDMNFGT PEEPRGTKRP NEFLRDVLGI SDLMHEYFNP  180
TAFTKVFSDM SNPPHPSDVH PNSLLMDAKP LKLLKSSGCI AAVYSGSHSL VQIPDESEEA  240
VCVTSFNYGM TDNQLAPFSN GVVSDYPIFD GNPSTSWTAQ RPMKTELPSV QNSNYGLGDA  300
CVYDCPSGSF ELADSLLESP GSPKSESISS HYSLDAILYK GDGIVDPTMS QVVFEPPFSC  360
NQVPQSNAHS LWHFTSVPGD DEIEDYPHSE IQASKPPSSS DAILAENKCN PDTSFTGRGL  420
ARAVAEPGWV RAGRGVGEAA APRVAVAGLG VGGFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-282112424126MYB TRANSFORMING PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129022331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26930.15e-52myb domain protein 97